(data stored in ACNUC7421 zone)

EMBL: CP001700.PE64

CP001700.PE64        Location/Qualifiers
FT   CDS             64495..65247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0064"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sma:SAV_7535 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69019"
FT                   /db_xref="GOA:C7QH80"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH80"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACU69019.1"
FT                   /translation="MSGDADPTGLSSTAATARNPVFRWASERSVNLGAMPRLALFDLDD
FT                   TLISSKGAFIAWTEELVAAHSSPADVRWFIDNEHIFWTGSPDDAFRGLVEHFGLAADPA
FT                   ELLADYQFRMVDLLKPFDGVLDGLEALRDAGWRIGIVTNGFGDFQNAKIDAVGLRAYVD
FT                   VVCISDVEGSWKPESKIFQLASERAGAPLEGGWMVGDSLSSDIAGGNGVGLHTAWIRHG
FT                   RTLGSMDPQPEQVVETTTEAFQLILSRP"
     MSGDADPTGL SSTAATARNP VFRWASERSV NLGAMPRLAL FDLDDTLISS KGAFIAWTEE        60
     LVAAHSSPAD VRWFIDNEHI FWTGSPDDAF RGLVEHFGLA ADPAELLADY QFRMVDLLKP       120
     FDGVLDGLEA LRDAGWRIGI VTNGFGDFQN AKIDAVGLRA YVDVVCISDV EGSWKPESKI       180
     FQLASERAGA PLEGGWMVGD SLSSDIAGGN GVGLHTAWIR HGRTLGSMDP QPEQVVETTT       240
     EAFQLILSRP                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page