(data stored in ACNUC7421 zone)

EMBL: CP001700.PE65

CP001700.PE65        Location/Qualifiers
FT   CDS             65385..66143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0065"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: TipAS antibiotic-recognition domain protein;
FT                   regulatory protein MerR; SMART: regulatory protein MerR;
FT                   KEGG: sgr:SGR_941 MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69020"
FT                   /db_xref="GOA:C7QH81"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH81"
FT                   /inference="protein motif:PFAM:PF07739"
FT                   /protein_id="ACU69020.1"
FT                   /translation="MSWSIAQVARMSGVTARTLRHYDDIGLLKPDHVGANGYRYYEEAQ
FT                   LLRLQQILVLRELGLGLSEIAEAIDSEPDTIVALRRQYGRLLVERDRLSRVAETVRRTI
FT                   AELEGKPQMSVHINRPENLFEGFEESQYEDEARERWPEEFEQAQAKRATMTEEDLERWQ
FT                   REATAAMIRMAEFMAAGTPVDDPAVQDEVHQHYQGICIWWTPNRSAYKCVGQMYVDDER
FT                   FKANYLKIAEGLAEYQAAAMAAYADARLTD"
     MSWSIAQVAR MSGVTARTLR HYDDIGLLKP DHVGANGYRY YEEAQLLRLQ QILVLRELGL        60
     GLSEIAEAID SEPDTIVALR RQYGRLLVER DRLSRVAETV RRTIAELEGK PQMSVHINRP       120
     ENLFEGFEES QYEDEARERW PEEFEQAQAK RATMTEEDLE RWQREATAAM IRMAEFMAAG       180
     TPVDDPAVQD EVHQHYQGIC IWWTPNRSAY KCVGQMYVDD ERFKANYLKI AEGLAEYQAA       240
     AMAAYADARL TD                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page