(data stored in ACNUC7421 zone)

EMBL: CP001700.PE66

CP001700.PE66        Location/Qualifiers
FT   CDS             complement(66209..67510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0066"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; sodium/hydrogen exchanger; KEGG:
FT                   sgr:SGR_3327 putative sodium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69021"
FT                   /db_xref="GOA:C7QH82"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH82"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ACU69021.1"
FT                   /translation="MTPPDRPASPSRVFARLKRIERRHVAAVLRTETVGGALLIAFALL
FT                   GLLWANSPWRASYDTVKNTVVGPHLWHLDLSLADWAADFLLAFFFLVAGIELKHELQAG
FT                   ELSNPRAAALPVVSALCGMIVPIGVYLAVSAGHTNAGEGWAVPTATDIAFALAVLAVVG
FT                   QNLPSALRAFLLTLAVVDDLGAIIIIAIAYTDSIDTGALVIAAVLLLAFYVVQRMRITS
FT                   LWLNVPLGLAIWIAVHASGVHATVAGVAIGLMLRGRRHGDSDEDHDDELQSPAEKVQWR
FT                   LQPFSAGFCVPVFAIMSAGVYVGGKTLGSLVSDQIPLAIAAGLFIGKAVGVFGGAYLTA
FT                   RFTRAELSDELQWRDIAAVSALTGVGFTVSLLIAELGFSDSPDVLNLAKGGVLLGSLAS
FT                   ALFAVVLLRRRDRFYDQLCTAEESEDSELVLGRE"
     MTPPDRPASP SRVFARLKRI ERRHVAAVLR TETVGGALLI AFALLGLLWA NSPWRASYDT        60
     VKNTVVGPHL WHLDLSLADW AADFLLAFFF LVAGIELKHE LQAGELSNPR AAALPVVSAL       120
     CGMIVPIGVY LAVSAGHTNA GEGWAVPTAT DIAFALAVLA VVGQNLPSAL RAFLLTLAVV       180
     DDLGAIIIIA IAYTDSIDTG ALVIAAVLLL AFYVVQRMRI TSLWLNVPLG LAIWIAVHAS       240
     GVHATVAGVA IGLMLRGRRH GDSDEDHDDE LQSPAEKVQW RLQPFSAGFC VPVFAIMSAG       300
     VYVGGKTLGS LVSDQIPLAI AAGLFIGKAV GVFGGAYLTA RFTRAELSDE LQWRDIAAVS       360
     ALTGVGFTVS LLIAELGFSD SPDVLNLAKG GVLLGSLASA LFAVVLLRRR DRFYDQLCTA       420
     EESEDSELVL GRE                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page