(data stored in ACNUC7421 zone)

EMBL: CP001700.PE67

CP001700.PE67        Location/Qualifiers
FT   CDS             complement(67729..69684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0067"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: sgr:SGR_3326 putative
FT                   acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69022"
FT                   /db_xref="GOA:C7QH83"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH83"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ACU69022.1"
FT                   /translation="MSNEALSNLLREDRRFAPSAAFAADANVKADAYAAAEADRLAFWD
FT                   TQASRLSWDTPWSETLDWSGMPVAKWFVGGKLNVAYNCVDRHVEAGNGDRVAIHFEGEP
FT                   GDSRAITYAELKDEVSKAANALTELGVRQGDRVAIYMPMIPETAVAMLACARIGAVHSV
FT                   VFAAFSPDALRARIEDAGAKLLITADGYHRRGGTVNLKANADEAVNGAETIENVLVVKR
FT                   TGADVAWGDKDVWWHDAVGGASTEHTPEAFDSENPLFILYTSGTTGKPKGILHTTGGYL
FT                   TQASYTHHAVFDLKPESDVYWCTADVGWVTGHSYIVYGPLSNGVTEVMYEGTPDTPHQG
FT                   RFWEIIQKYKVSLLYTAPTAIRMFAKWGDDIPAKFDLSSLRLLGSVGEPINPEAWIWYR
FT                   KNIGGDRTPVVDTWWQTETGAIMISPLPGVTEAKPGSAMRPLPGISANVVDKDGNIVGN
FT                   GHGGLLVLDKPWPSMARGIWGDQQRFIDTYWARFAEQGYYFAGDGAKKDEDGDLWLLGR
FT                   VDDIMLVSGHNISTTEVESALVSYPAVAEAAVVGAKDETTGQRIVAFVILRAGQEETEG
FT                   LDAALKAHVSKEIGPIAKPKQIQIVPELPKTRSGKIMRRLLKDVAEDRVVGDTTTLADS
FT                   TVMDLIKAKLPHANED"
     MSNEALSNLL REDRRFAPSA AFAADANVKA DAYAAAEADR LAFWDTQASR LSWDTPWSET        60
     LDWSGMPVAK WFVGGKLNVA YNCVDRHVEA GNGDRVAIHF EGEPGDSRAI TYAELKDEVS       120
     KAANALTELG VRQGDRVAIY MPMIPETAVA MLACARIGAV HSVVFAAFSP DALRARIEDA       180
     GAKLLITADG YHRRGGTVNL KANADEAVNG AETIENVLVV KRTGADVAWG DKDVWWHDAV       240
     GGASTEHTPE AFDSENPLFI LYTSGTTGKP KGILHTTGGY LTQASYTHHA VFDLKPESDV       300
     YWCTADVGWV TGHSYIVYGP LSNGVTEVMY EGTPDTPHQG RFWEIIQKYK VSLLYTAPTA       360
     IRMFAKWGDD IPAKFDLSSL RLLGSVGEPI NPEAWIWYRK NIGGDRTPVV DTWWQTETGA       420
     IMISPLPGVT EAKPGSAMRP LPGISANVVD KDGNIVGNGH GGLLVLDKPW PSMARGIWGD       480
     QQRFIDTYWA RFAEQGYYFA GDGAKKDEDG DLWLLGRVDD IMLVSGHNIS TTEVESALVS       540
     YPAVAEAAVV GAKDETTGQR IVAFVILRAG QEETEGLDAA LKAHVSKEIG PIAKPKQIQI       600
     VPELPKTRSG KIMRRLLKDV AEDRVVGDTT TLADSTVMDL IKAKLPHANE D                651
//

If you have problems or comments...

PBIL Back to PBIL home page