(data stored in ACNUC7421 zone)

EMBL: CP001700.PE68

CP001700.PE68        Location/Qualifiers
FT   CDS             complement(70063..70797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0068"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-
FT                   binding region; SMART: response regulator receiver; KEGG:
FT                   stp:Strop_4494 LytTr DNA-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69023"
FT                   /db_xref="GOA:C7QH84"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH84"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69023.1"
FT                   /translation="MTIATPTGLRVLVVDDEPPAVAELAYLLSRDPRVSSVRTATDGED
FT                   ALRVLKNSPVDALFLDIRMPGLDGLEIAALLNQFATPPQIVFVTAHEEFALEAFDLHAS
FT                   DYILKPVRAERLAEALRRMTPASAPPRAPEAGPYDVIPVELAGVTRFIPRQEVSYAEAQ
FT                   GDYVRLYTASSSHLVRIPLAVLEEHWSGAGFARTHRRFLVRVDAVSEARWESGHLTVIV
FT                   GGVPIPVARRHTREVRERLSHR"
     MTIATPTGLR VLVVDDEPPA VAELAYLLSR DPRVSSVRTA TDGEDALRVL KNSPVDALFL        60
     DIRMPGLDGL EIAALLNQFA TPPQIVFVTA HEEFALEAFD LHASDYILKP VRAERLAEAL       120
     RRMTPASAPP RAPEAGPYDV IPVELAGVTR FIPRQEVSYA EAQGDYVRLY TASSSHLVRI       180
     PLAVLEEHWS GAGFARTHRR FLVRVDAVSE ARWESGHLTV IVGGVPIPVA RRHTREVRER       240
     LSHR                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page