(data stored in ACNUC7421 zone)

EMBL: CP001700.PE69

CP001700.PE69        Location/Qualifiers
FT   CDS             complement(70820..72022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0069"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; KEGG: nca:Noca_0358 histidine kinase
FT                   internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69024"
FT                   /db_xref="GOA:C7QH85"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH85"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACU69024.1"
FT                   /translation="MASNPATVGIVAALVAPAVAVSRAVQRHRLAGTSAERAAYAAMHA
FT                   VALAGPPLRGGLTPDATRRAARHLRPLLGTAALAFNDTERTLTWDGAGQHRHSQDSYEL
FT                   STTALKSGSVSVLGPEEVHCGSDSCMIRHAVVAPIIPPSSIGGIRADGGSTAIGTLSVY
FT                   SSSTSVALVRAVGEVAYWVATQIELAELDRSRTLLMETELRALRAQISPHFIYNSLTAI
FT                   ASFTRTDPQRARELLLEFADFTRYSFRAHGEFTTLAEELRCVDRYLLLERARFGERLQV
FT                   ALRIAPEVLPVEVPFLCVQPIVENAVRHGLEGKPGPGHVTITAEPTRHDYRITVADDGV
FT                   GITPDILRDALAPAEPGTRTSVGLSNVHERLRAVYGTAYGLAIESEPGAGTTVVIRVPK
FT                   K"
     MASNPATVGI VAALVAPAVA VSRAVQRHRL AGTSAERAAY AAMHAVALAG PPLRGGLTPD        60
     ATRRAARHLR PLLGTAALAF NDTERTLTWD GAGQHRHSQD SYELSTTALK SGSVSVLGPE       120
     EVHCGSDSCM IRHAVVAPII PPSSIGGIRA DGGSTAIGTL SVYSSSTSVA LVRAVGEVAY       180
     WVATQIELAE LDRSRTLLME TELRALRAQI SPHFIYNSLT AIASFTRTDP QRARELLLEF       240
     ADFTRYSFRA HGEFTTLAEE LRCVDRYLLL ERARFGERLQ VALRIAPEVL PVEVPFLCVQ       300
     PIVENAVRHG LEGKPGPGHV TITAEPTRHD YRITVADDGV GITPDILRDA LAPAEPGTRT       360
     SVGLSNVHER LRAVYGTAYG LAIESEPGAG TTVVIRVPKK                             400
//

If you have problems or comments...

PBIL Back to PBIL home page