(data stored in ACNUC7421 zone)

EMBL: CP001700.PE7

CP001700.PE7         Location/Qualifiers
FT   CDS             9293..11920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: sma:SAV_4322 DNA gyrase subunit A; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68962"
FT                   /db_xref="GOA:C7QFM3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM3"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACU68962.1"
FT                   /translation="MDETPQGDRIDPVDLQTEMQRSYLDYAMSVIVGRALPDVRDGLKP
FT                   VHRRVLYAMYDGGYRPEKGYYKCARVVGEVMGIYHPHGDSPIYDTLVRLAQPWSLRMVL
FT                   VDGNGNFGSPGNDPAAAMRYTECKMAPLAMEMVRDIDEDTVDFRPNYDGRSSEPVVLPA
FT                   RFPNLLVNGSTGIAVGMATNIPSHNLREVNDGVQWFLQNPEATNEELLEALIERIKGPD
FT                   FPTGALIVGRRGIEDAYRTGRGSITMRAVVNTEEINGRMCLVVTELPYQVNPDNLALKI
FT                   AELVKDGKVAGIADVRDESSSRTGQRLVIVLKRDAVAKVVLNNLYKHTQLQDSFGANML
FT                   ALVDDVPRTLSLDAFIRHWVTHQIDVIVRRTRFRLRKAQERAHILVGLLKALDAIDEVV
FT                   ALIRRSPTVDEARSGLIELLTIDEIQANAILEMQLRRLAALERQRIEAEHNELMAKIAD
FT                   YTAILESPERQRRIVSEELQAISDKYGDDRRSQLVPYEGDMSIEDLIPEEDVVVTITRG
FT                   GYTRRTRTDLYRSQKRGGKGVKGAQLKQDDIVDHFFVTTTHHWLLFFTNKGRVYRAKAH
FT                   ELPDTARDARGQHVANLLAFLPDEKIAQVLDLRDYEQTPYLVLATKNGLIKKTPLKDYD
FT                   SPRSAGVIAINLREDDELIAAELVSPEDDLLLVSKQAQGLRFTATDEALRPMGRATSGV
FT                   IGMRFREDDELLSMDVVRPDTFLFTATSGGYGKRTAVEMFPLRGRGGLGVIAAKTVDER
FT                   GGLVGAAVVDEGDEVMAITLSGGVIRTRVSEVRPTSRDTMGVRVINLGKGDTVLAIARN
FT                   GDPGEVEDELGEEAGAPAEAAGADVVAEARENGAVVEASEGSEVIDESEGSDESDGSEA
FT                   SSEE"
     MDETPQGDRI DPVDLQTEMQ RSYLDYAMSV IVGRALPDVR DGLKPVHRRV LYAMYDGGYR        60
     PEKGYYKCAR VVGEVMGIYH PHGDSPIYDT LVRLAQPWSL RMVLVDGNGN FGSPGNDPAA       120
     AMRYTECKMA PLAMEMVRDI DEDTVDFRPN YDGRSSEPVV LPARFPNLLV NGSTGIAVGM       180
     ATNIPSHNLR EVNDGVQWFL QNPEATNEEL LEALIERIKG PDFPTGALIV GRRGIEDAYR       240
     TGRGSITMRA VVNTEEINGR MCLVVTELPY QVNPDNLALK IAELVKDGKV AGIADVRDES       300
     SSRTGQRLVI VLKRDAVAKV VLNNLYKHTQ LQDSFGANML ALVDDVPRTL SLDAFIRHWV       360
     THQIDVIVRR TRFRLRKAQE RAHILVGLLK ALDAIDEVVA LIRRSPTVDE ARSGLIELLT       420
     IDEIQANAIL EMQLRRLAAL ERQRIEAEHN ELMAKIADYT AILESPERQR RIVSEELQAI       480
     SDKYGDDRRS QLVPYEGDMS IEDLIPEEDV VVTITRGGYT RRTRTDLYRS QKRGGKGVKG       540
     AQLKQDDIVD HFFVTTTHHW LLFFTNKGRV YRAKAHELPD TARDARGQHV ANLLAFLPDE       600
     KIAQVLDLRD YEQTPYLVLA TKNGLIKKTP LKDYDSPRSA GVIAINLRED DELIAAELVS       660
     PEDDLLLVSK QAQGLRFTAT DEALRPMGRA TSGVIGMRFR EDDELLSMDV VRPDTFLFTA       720
     TSGGYGKRTA VEMFPLRGRG GLGVIAAKTV DERGGLVGAA VVDEGDEVMA ITLSGGVIRT       780
     RVSEVRPTSR DTMGVRVINL GKGDTVLAIA RNGDPGEVED ELGEEAGAPA EAAGADVVAE       840
     ARENGAVVEA SEGSEVIDES EGSDESDGSE ASSEE                                  875
//

If you have problems or comments...

PBIL Back to PBIL home page