(data stored in ACNUC7421 zone)

EMBL: CP001700.PE70

CP001700.PE70        Location/Qualifiers
FT   CDS             72113..72721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0070"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nca:Noca_1231
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69025"
FT                   /db_xref="GOA:C7QH86"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH86"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69025.1"
FT                   /translation="MNGRAIFLRVSKGEETRRQVLEAAVEVAASTGLASLTIGSLAERA
FT                   GMSKSGLFAHFKSKETLQVQVLEFASEAFVEDVVRPALSAPRGEKRITTLFESWLAVSR
FT                   DGTAECLFVSAAWEYDDQPGPVRDRLVRMHLDFNDSVAQMFRTGIAEGFFAADADPEQF
FT                   AHDLHGIMLIFFQAHRLLGDARAEERARSAFSRLIESNR"
     MNGRAIFLRV SKGEETRRQV LEAAVEVAAS TGLASLTIGS LAERAGMSKS GLFAHFKSKE        60
     TLQVQVLEFA SEAFVEDVVR PALSAPRGEK RITTLFESWL AVSRDGTAEC LFVSAAWEYD       120
     DQPGPVRDRL VRMHLDFNDS VAQMFRTGIA EGFFAADADP EQFAHDLHGI MLIFFQAHRL       180
     LGDARAEERA RSAFSRLIES NR                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page