(data stored in ACNUC7421 zone)

EMBL: CP001700.PE71

CP001700.PE71        Location/Qualifiers
FT   CDS             72736..73662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nca:Noca_1230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69026"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH87"
FT                   /inference="similar to AA sequence:KEGG:Noca_1230"
FT                   /protein_id="ACU69026.1"
FT                   /translation="MAVSSSSGKKSTTVRAKKALGIGTVRTAFKVLEVVAPGPGARWAE
FT                   RLWLTVPKKPWRPRTPIAVSAGEPFTVTVRRSTVHGTVWGADGPLVYLMHGWGGVAAQL
FT                   DAFVEPLLAAGYRVVSFDAPGHGRSTESFAGPGLATLPEFSEALSSAVDRFGEAHAVIA
FT                   HSFGAAAAVLSVLDGLPVGRLVVVAPVSDPIGFSYEFAKMLGFRERIRTGFLRVLEKRV
FT                   GVSMDRFDIPQRMRDADLTTLPPLLIVHDLGDREVPVASGDRLAALWPGAELDTWTSLG
FT                   HFRILTDPDVVRKVTAFSSVPRTLPVP"
     MAVSSSSGKK STTVRAKKAL GIGTVRTAFK VLEVVAPGPG ARWAERLWLT VPKKPWRPRT        60
     PIAVSAGEPF TVTVRRSTVH GTVWGADGPL VYLMHGWGGV AAQLDAFVEP LLAAGYRVVS       120
     FDAPGHGRST ESFAGPGLAT LPEFSEALSS AVDRFGEAHA VIAHSFGAAA AVLSVLDGLP       180
     VGRLVVVAPV SDPIGFSYEF AKMLGFRERI RTGFLRVLEK RVGVSMDRFD IPQRMRDADL       240
     TTLPPLLIVH DLGDREVPVA SGDRLAALWP GAELDTWTSL GHFRILTDPD VVRKVTAFSS       300
     VPRTLPVP                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page