(data stored in ACNUC7421 zone)

EMBL: CP001700.PE72

CP001700.PE72        Location/Qualifiers
FT   CDS             complement(73628..74605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69027"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH88"
FT                   /inference="similar to AA sequence:KEGG:SGR_3324"
FT                   /protein_id="ACU69027.1"
FT                   /translation="MRIALVGKGGSGKTTVSALLIRHLAAGGRPVLAVDADINQHLGGA
FT                   LGLSEEQAAALSPMAAHLPAIKDYLRGENPLISGTEAMVKTTPPGRGSRLLRLEEENAV
FT                   HSLCATRLPGDMENVRLMVTGGFEEKDLGVSCYHSKIGAAELYLNHLVDGPDEYLVMDM
FT                   TAGADAFASGLFTRFDLTCLVVEPTRKSVSVYQQYREYAKEYDVTIRVVGNKVTGPDDV
FT                   AYLREHTGADLVACLSASHYVRAQEQGRDKGFDTLEPANRTALARLQLEVDAVPQDWAK
FT                   FTRQAVHFHLKNAHAWGDRATGVDLGAQVDPDFVMGPEAFAAQS"
     MRIALVGKGG SGKTTVSALL IRHLAAGGRP VLAVDADINQ HLGGALGLSE EQAAALSPMA        60
     AHLPAIKDYL RGENPLISGT EAMVKTTPPG RGSRLLRLEE ENAVHSLCAT RLPGDMENVR       120
     LMVTGGFEEK DLGVSCYHSK IGAAELYLNH LVDGPDEYLV MDMTAGADAF ASGLFTRFDL       180
     TCLVVEPTRK SVSVYQQYRE YAKEYDVTIR VVGNKVTGPD DVAYLREHTG ADLVACLSAS       240
     HYVRAQEQGR DKGFDTLEPA NRTALARLQL EVDAVPQDWA KFTRQAVHFH LKNAHAWGDR       300
     ATGVDLGAQV DPDFVMGPEA FAAQS                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page