(data stored in ACNUC7421 zone)

EMBL: CP001700.PE73

CP001700.PE73        Location/Qualifiers
FT   CDS             74795..75577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69028"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH89"
FT                   /inference="similar to AA sequence:KEGG:SAV_4603"
FT                   /protein_id="ACU69028.1"
FT                   /translation="MDTRSPIQRLAAAPNAAEAADTAREAVDRVRRHKVLRSQSARVTA
FT                   ESQLRGARASAALGSLSEAGTDWPLEEVRRRTDLGDEDGSGLLRGALRISGELGTLAPV
FT                   WKRSPIQALSRMHLLAAAGHLDQDRVGRPSGPEAAVTLTTLANELRDPAAAEVPAVVVA
FT                   AAVHAELLVNEPFGWGDGLLARAASRLILADRGLDPQSLAVVEAGHVDVGVEKYLDAAR
FT                   DYATGTEEGLATWLGLYAEAVELGARESLAVCEAIMRG"
     MDTRSPIQRL AAAPNAAEAA DTAREAVDRV RRHKVLRSQS ARVTAESQLR GARASAALGS        60
     LSEAGTDWPL EEVRRRTDLG DEDGSGLLRG ALRISGELGT LAPVWKRSPI QALSRMHLLA       120
     AAGHLDQDRV GRPSGPEAAV TLTTLANELR DPAAAEVPAV VVAAAVHAEL LVNEPFGWGD       180
     GLLARAASRL ILADRGLDPQ SLAVVEAGHV DVGVEKYLDA ARDYATGTEE GLATWLGLYA       240
     EAVELGARES LAVCEAIMRG                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page