(data stored in ACNUC7421 zone)

EMBL: CP001700.PE74

CP001700.PE74        Location/Qualifiers
FT   CDS             complement(75654..76394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0074"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ank:AnaeK_2958 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69029"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH90"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69029.1"
FT                   /translation="MSAQGKFTGKTVYVIGASHGIGEGIAAAFAGGGADVLITGRAKER
FT                   LDAAAERIGHPVRVVQSDATRQEDVDALFAAADTKIDHLVLAVSGGMAGLGPLAELTDE
FT                   ALREGFESKVFAQFRVLKAALPHLAPDASVTFIGAGSSRAAFPGTTALAAANGALDAAV
FT                   RPLAAELAPVRVNAVSPGVIDTAWWHPLGENRDGFMEQQAAATPVGRVGQPQDIAEAVL
FT                   FLAGNGFTTGVVLDVNGGTTLARG"
     MSAQGKFTGK TVYVIGASHG IGEGIAAAFA GGGADVLITG RAKERLDAAA ERIGHPVRVV        60
     QSDATRQEDV DALFAAADTK IDHLVLAVSG GMAGLGPLAE LTDEALREGF ESKVFAQFRV       120
     LKAALPHLAP DASVTFIGAG SSRAAFPGTT ALAAANGALD AAVRPLAAEL APVRVNAVSP       180
     GVIDTAWWHP LGENRDGFME QQAAATPVGR VGQPQDIAEA VLFLAGNGFT TGVVLDVNGG       240
     TTLARG                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page