(data stored in ACNUC7421 zone)

EMBL: CP001700.PE75

CP001700.PE75        Location/Qualifiers
FT   CDS             76491..77075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0075"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL3321
FT                   2,4-DAPG biosynthesis transcriptional repressor PhlF"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69030"
FT                   /db_xref="GOA:C7QH91"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH91"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69030.1"
FT                   /translation="MERPHTGRRRNEAAREAIIDAAIGLLQEVGYEGFTIERLARDAGV
FT                   GKQTVYRWWPSKAAVIAEAVGTRAQHTIPLPDTGTLAADLREFFETTFRQSEDPKVISE
FT                   LKSMMVASIENPESARPFHDFLASRRATLRVLLERGSARAEVAADADLDFLTDLAYGLL
FT                   WYRGLVGHRPLDDDAARKLAGALVAAAAESQ"
     MERPHTGRRR NEAAREAIID AAIGLLQEVG YEGFTIERLA RDAGVGKQTV YRWWPSKAAV        60
     IAEAVGTRAQ HTIPLPDTGT LAADLREFFE TTFRQSEDPK VISELKSMMV ASIENPESAR       120
     PFHDFLASRR ATLRVLLERG SARAEVAADA DLDFLTDLAY GLLWYRGLVG HRPLDDDAAR       180
     KLAGALVAAA AESQ                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page