(data stored in ACNUC7421 zone)

EMBL: CP001700.PE76

CP001700.PE76        Location/Qualifiers
FT   CDS             77516..78517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0076"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sco:SCO3823 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69031"
FT                   /db_xref="GOA:C7QH92"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH92"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACU69031.1"
FT                   /translation="MRAITIAEPGGPEQLVWTEVPDPVVAAGEVLIQVAATAVNRADIL
FT                   QRRGFYTPPPGASSYPGLECSGRVVEVGAGVSGFVPGDEVVALLTGGGYAELVAVPAGQ
FT                   VAPLPKGLSALAAGGLMETVCTVWSNVFMLAGLQAGQTLLVHGGSSGIGTTAIQLAHQL
FT                   GARVIVTAGTAAKLRACRDLGADVGVNYRDEDFVERVAEVTDGQGVDVILDNMGAVYLD
FT                   RNVQALAVDGRLVIIGLQGGVTGEVNLNTLLRKRAGISATTLRARPSEEKARIVAAARD
FT                   AVWPLIEQGRFRVVVDRVLPVDRAAEAHRVVEDSGHVGKVVLDVATVRGSSS"
     MRAITIAEPG GPEQLVWTEV PDPVVAAGEV LIQVAATAVN RADILQRRGF YTPPPGASSY        60
     PGLECSGRVV EVGAGVSGFV PGDEVVALLT GGGYAELVAV PAGQVAPLPK GLSALAAGGL       120
     METVCTVWSN VFMLAGLQAG QTLLVHGGSS GIGTTAIQLA HQLGARVIVT AGTAAKLRAC       180
     RDLGADVGVN YRDEDFVERV AEVTDGQGVD VILDNMGAVY LDRNVQALAV DGRLVIIGLQ       240
     GGVTGEVNLN TLLRKRAGIS ATTLRARPSE EKARIVAAAR DAVWPLIEQG RFRVVVDRVL       300
     PVDRAAEAHR VVEDSGHVGK VVLDVATVRG SSS                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page