(data stored in ACNUC7421 zone)

EMBL: CP001700.PE77

CP001700.PE77        Location/Qualifiers
FT   CDS             78533..79129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69032"
FT                   /db_xref="GOA:C7QH93"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH93"
FT                   /inference="similar to AA sequence:KEGG:SGR_3755"
FT                   /protein_id="ACU69032.1"
FT                   /translation="MTGLNGDIFGAMNMSLNNDPDADHDGDLAGRVIVVPADAAGARGD
FT                   DESGENPMNVAEMVEQPAKVMRIGSMIKQLLEEVRAAPLDEASRARLREIHRSSIAELE
FT                   KGLAPELVAELERLSLPFAEDEVPSESELRIAQAQLVGWLEGLFHGIQTALFAQQMAAR
FT                   AQLEQIRRALPPGSVPPGMADGEQPGRISGAGPYL"
     MTGLNGDIFG AMNMSLNNDP DADHDGDLAG RVIVVPADAA GARGDDESGE NPMNVAEMVE        60
     QPAKVMRIGS MIKQLLEEVR AAPLDEASRA RLREIHRSSI AELEKGLAPE LVAELERLSL       120
     PFAEDEVPSE SELRIAQAQL VGWLEGLFHG IQTALFAQQM AARAQLEQIR RALPPGSVPP       180
     GMADGEQPGR ISGAGPYL                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page