(data stored in ACNUC7421 zone)

EMBL: CP001700.PE78

CP001700.PE78        Location/Qualifiers
FT   CDS             complement(79104..80204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0078"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sgr:SGR_3762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69033"
FT                   /db_xref="GOA:C7QH94"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH94"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACU69033.1"
FT                   /translation="MPGTSGPLQALFLRFGLPAPTAFRPVDSGLLNRSYQITSADRRYF
FT                   LKHYLPWRGIGSGLPDAYGRRRSAAQTLRWQHEAVIRLQAAGLPAVAPLRDVHGRTVAY
FT                   VRGRPFAVFPWNDGVHRHGRHMHDIDARCLGTTLADVHTGLARVLPQVPQPLFVPTASE
FT                   RRAVAEAEQLLAVVDSGPGRDEMDLLSAHRLRERLALIPEVAHLRPAPDAVATVGYIHG
FT                   DFHAGNVMWSALEPGSRVTAIVDWEKTAVAPCGDEVVSTALVFFTGDYSGQLDLDLVRA
FT                   FIGGYAAARPQFSEQELADSVRRVWWERLTDFWILTWHYHHADHRADSLFPATAALVPW
FT                   WTENYAKVLDAFLEGAAAATGTVPRR"
     MPGTSGPLQA LFLRFGLPAP TAFRPVDSGL LNRSYQITSA DRRYFLKHYL PWRGIGSGLP        60
     DAYGRRRSAA QTLRWQHEAV IRLQAAGLPA VAPLRDVHGR TVAYVRGRPF AVFPWNDGVH       120
     RHGRHMHDID ARCLGTTLAD VHTGLARVLP QVPQPLFVPT ASERRAVAEA EQLLAVVDSG       180
     PGRDEMDLLS AHRLRERLAL IPEVAHLRPA PDAVATVGYI HGDFHAGNVM WSALEPGSRV       240
     TAIVDWEKTA VAPCGDEVVS TALVFFTGDY SGQLDLDLVR AFIGGYAAAR PQFSEQELAD       300
     SVRRVWWERL TDFWILTWHY HHADHRADSL FPATAALVPW WTENYAKVLD AFLEGAAAAT       360
     GTVPRR                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page