(data stored in ACNUC7421 zone)

EMBL: CP001700.PE79

CP001700.PE79        Location/Qualifiers
FT   CDS             80355..81437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0079"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: ace:Acel_0767
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69034"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH95"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ACU69034.1"
FT                   /translation="MAASARGHRRAPKRSRRSPLRAVALFVISTALVVGSGVAFGYATH
FT                   HLGKHQVTDDASVVAPPTGPLSDATDDPSATTNSAPGGKPSVPASPRPSLPKATGPGKV
FT                   TELKVASSDDDWPSRPVFVYRPAVPANVVLPVVYLLHGVPGEPDRIMDAVKAVLDKAFT
FT                   SGGEQPFIVAAPTGEGTAHNDTEWADAVDGKDMVETYMIKDVIPAVEGKTPRPAGMRAI
FT                   VGFSMGGYGAANLTLRHPDLFDQFASMAGYFRVDDPDGMFGSDSKIEAANTPDDMVQKA
FT                   AGKRVLLLEDQQDPDPLIQGEASEFAKRLDDCNCGVDLSWHLEPGGHTYDFVTDSFPKV
FT                   ITFLNQGFTAPAGTTPSAAG"
     MAASARGHRR APKRSRRSPL RAVALFVIST ALVVGSGVAF GYATHHLGKH QVTDDASVVA        60
     PPTGPLSDAT DDPSATTNSA PGGKPSVPAS PRPSLPKATG PGKVTELKVA SSDDDWPSRP       120
     VFVYRPAVPA NVVLPVVYLL HGVPGEPDRI MDAVKAVLDK AFTSGGEQPF IVAAPTGEGT       180
     AHNDTEWADA VDGKDMVETY MIKDVIPAVE GKTPRPAGMR AIVGFSMGGY GAANLTLRHP       240
     DLFDQFASMA GYFRVDDPDG MFGSDSKIEA ANTPDDMVQK AAGKRVLLLE DQQDPDPLIQ       300
     GEASEFAKRL DDCNCGVDLS WHLEPGGHTY DFVTDSFPKV ITFLNQGFTA PAGTTPSAAG       360
//

If you have problems or comments...

PBIL Back to PBIL home page