(data stored in ACNUC7421 zone)

EMBL: CP001700.PE8

CP001700.PE8         Location/Qualifiers
FT   CDS             12855..13391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68963"
FT                   /db_xref="GOA:C7QFM4"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM4"
FT                   /inference="similar to AA sequence:KEGG:SAV_4323"
FT                   /protein_id="ACU68963.1"
FT                   /translation="MGTVAYQQSDSAQGQAGTRQQAGGGWGARPNSPAGAPTGAPRYQQ
FT                   QQAPAAAPRGRKARLRVAKVDPWSVMKTTFVLSIAFAVVSVVAAALLWSALNALGVFDS
FT                   INHTLASVAPANQPNSVTLTSVLSFGKVLSFTALVSVVNIVLFTALATLAAYLYNMCSS
FT                   LVGGIEVTLADDTAS"
     MGTVAYQQSD SAQGQAGTRQ QAGGGWGARP NSPAGAPTGA PRYQQQQAPA AAPRGRKARL        60
     RVAKVDPWSV MKTTFVLSIA FAVVSVVAAA LLWSALNALG VFDSINHTLA SVAPANQPNS       120
     VTLTSVLSFG KVLSFTALVS VVNIVLFTAL ATLAAYLYNM CSSLVGGIEV TLADDTAS         178
//

If you have problems or comments...

PBIL Back to PBIL home page