(data stored in ACNUC7421 zone)

EMBL: CP001700.PE80

CP001700.PE80        Location/Qualifiers
FT   CDS             complement(81501..82199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69035"
FT                   /db_xref="GOA:C7QH96"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69035.1"
FT                   /translation="MRNLLGSLLAIIGAAATLVSPWQAWYNNRHGSSYKFYEVFGSGVT
FT                   LSGSGIMDSVFLVFLITAVLAVAGVVLRSRALVGAAGVIAFGFTILWMVRQGQAAGELT
FT                   VTGANNRGLGSGVAYAFGGGLLMIIGSLMMTGRTRRTVVAEPARTKTADQAMYGTAATT
FT                   SAPPAITTTAPADKNPVPPAAAPAATPAQTSASAAPTASERTGTERLSKEERQMLGLDE
FT                   DASAEPKKQN"
     MRNLLGSLLA IIGAAATLVS PWQAWYNNRH GSSYKFYEVF GSGVTLSGSG IMDSVFLVFL        60
     ITAVLAVAGV VLRSRALVGA AGVIAFGFTI LWMVRQGQAA GELTVTGANN RGLGSGVAYA       120
     FGGGLLMIIG SLMMTGRTRR TVVAEPARTK TADQAMYGTA ATTSAPPAIT TTAPADKNPV       180
     PPAAAPAATP AQTSASAAPT ASERTGTERL SKEERQMLGL DEDASAEPKK QN               232
//

If you have problems or comments...

PBIL Back to PBIL home page