(data stored in ACNUC7421 zone)

EMBL: CP001700.PE81

CP001700.PE81        Location/Qualifiers
FT   CDS             82507..84381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0081"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sgr:SGR_3434 putative heat shock protein
FT                   HSP70; TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69036"
FT                   /db_xref="GOA:C7QH97"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH97"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ACU69036.1"
FT                   /translation="MARPVGIDLGTTNSVVCVLEGGEPTVITNAEGSRTTPSVVAFAKN
FT                   GEVLVGEVAKRQAVTNVERTIRSVKRHMGTDWKIGIDEKNFTPQQISAFILQKLKRDAE
FT                   SYLSEKVTDAVITVPAYFSDSERQATKEAGEIAGLNVLRIVNEPTAAALAYGLDKGEGD
FT                   QTILVFDLGGGTFDVSLLEVGKDDDGFSTIEVKATNGDNHLGGDDWDNAVVEWLVTQFK
FT                   NAHGVDLSKDKMAMQRLREAGEKAKIELSSSTETSINLPYITASAEGPLHLDEKLTRSQ
FT                   FQQLTSDLLDRCKTPFHQVIKDAGVALSAIEHVVLVGGSTRMPAVADLVRELTGGKEPN
FT                   KGVNPDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIMTKLIEKNTTIPTK
FT                   RSETFTTAEDNQPSVQIQVYQGEREIAAYNKRLGMFELTGLPPAPRGLPQIEVTFDIDA
FT                   NGIVNVSAKDLGTGKVQSMVITGGSALPKDEIDRMMREAEQYADEDHSRREAAEVRNQA
FT                   ESLVYSTEKFLKDNEDKVPADVKSEVDAAIGETREALKSEDSATIRSASEKLATTSQKL
FT                   GAALYQQAQASGEAAGAPGGESAGAPGGGADDDVVDAEIVDEGKGGQA"
     MARPVGIDLG TTNSVVCVLE GGEPTVITNA EGSRTTPSVV AFAKNGEVLV GEVAKRQAVT        60
     NVERTIRSVK RHMGTDWKIG IDEKNFTPQQ ISAFILQKLK RDAESYLSEK VTDAVITVPA       120
     YFSDSERQAT KEAGEIAGLN VLRIVNEPTA AALAYGLDKG EGDQTILVFD LGGGTFDVSL       180
     LEVGKDDDGF STIEVKATNG DNHLGGDDWD NAVVEWLVTQ FKNAHGVDLS KDKMAMQRLR       240
     EAGEKAKIEL SSSTETSINL PYITASAEGP LHLDEKLTRS QFQQLTSDLL DRCKTPFHQV       300
     IKDAGVALSA IEHVVLVGGS TRMPAVADLV RELTGGKEPN KGVNPDEVVA VGAALQAGVL       360
     KGEVKDVLLL DVTPLSLGIE TKGGIMTKLI EKNTTIPTKR SETFTTAEDN QPSVQIQVYQ       420
     GEREIAAYNK RLGMFELTGL PPAPRGLPQI EVTFDIDANG IVNVSAKDLG TGKVQSMVIT       480
     GGSALPKDEI DRMMREAEQY ADEDHSRREA AEVRNQAESL VYSTEKFLKD NEDKVPADVK       540
     SEVDAAIGET REALKSEDSA TIRSASEKLA TTSQKLGAAL YQQAQASGEA AGAPGGESAG       600
     APGGGADDDV VDAEIVDEGK GGQA                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page