(data stored in ACNUC7421 zone)

EMBL: CP001700.PE82

CP001700.PE82        Location/Qualifiers
FT   CDS             84577..85245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0082"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: sma:SAV_4485 heat shock
FT                   protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69037"
FT                   /db_xref="GOA:C7QH98"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH98"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ACU69037.1"
FT                   /translation="MSDEYAAEREGEGERANLAVTELLAKLAERTNELQGVQAELSERT
FT                   NDLQRLQAEFSNYKKRVERDRQVVKETAVAGALSELLPVLDDIGRAREHGELEGGFRQV
FT                   GEAFEAVVAKLGLARFGAAGELFDPNLHEALLSTTSPDVDEVTVAVLFRPGYRIGERVV
FT                   RAAQVQVAEPGPALETEPAPEPAPKPKPAAPAAKRAPGGAGKTAAEPAAEVDDDDDSGL
FT                   "
     MSDEYAAERE GEGERANLAV TELLAKLAER TNELQGVQAE LSERTNDLQR LQAEFSNYKK        60
     RVERDRQVVK ETAVAGALSE LLPVLDDIGR AREHGELEGG FRQVGEAFEA VVAKLGLARF       120
     GAAGELFDPN LHEALLSTTS PDVDEVTVAV LFRPGYRIGE RVVRAAQVQV AEPGPALETE       180
     PAPEPAPKPK PAAPAAKRAP GGAGKTAAEP AAEVDDDDDS GL                          222
//

If you have problems or comments...

PBIL Back to PBIL home page