(data stored in ACNUC7421 zone)

EMBL: CP001700.PE83

CP001700.PE83        Location/Qualifiers
FT   CDS             85314..86438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0083"
FT                   /product="chaperone protein DnaJ"
FT                   /note="KEGG: sgr:SGR_3432 putative DnaJ protein; TIGRFAM:
FT                   chaperone protein DnaJ; PFAM: chaperone DnaJ domain
FT                   protein; heat shock protein DnaJ domain protein; DnaJ
FT                   central domain protein; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69038"
FT                   /db_xref="GOA:C7QH99"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH99"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ACU69038.1"
FT                   /translation="MAVNKDYYKILGVPKDAPAADIKKAYRKLARQYHPDANKGDAASE
FT                   EKFKEISEAYDVLSDDKRRKEYDDSRSVFGNGGFRAPGGGAPGGFNFDLGDLLGGLFNR
FT                   TGGPTTGTSTTGRTTQARRGSDVESEVTLKFSDSIDGATVSLRLTSDTPCSACSGTGAK
FT                   AGTTPRVCPTCSGTGQVSRNQGGFAFSEPCRDCKGRGLLVDDPCPVCHGSGRAASSRTI
FT                   QARIPAGVRDGQRIRLKGKGASGERGGPAGDLYVVVHVSPHPVFGREDDNLTVTVPVTF
FT                   PEAVLGADIQVPTLGGMPVTVKLPANSQNGRVLRVRGRGVARKDGTKGDLLVRFEIAVP
FT                   AEIGDDARAALQKFQEATGNHHPRAELLDSAKGE"
     MAVNKDYYKI LGVPKDAPAA DIKKAYRKLA RQYHPDANKG DAASEEKFKE ISEAYDVLSD        60
     DKRRKEYDDS RSVFGNGGFR APGGGAPGGF NFDLGDLLGG LFNRTGGPTT GTSTTGRTTQ       120
     ARRGSDVESE VTLKFSDSID GATVSLRLTS DTPCSACSGT GAKAGTTPRV CPTCSGTGQV       180
     SRNQGGFAFS EPCRDCKGRG LLVDDPCPVC HGSGRAASSR TIQARIPAGV RDGQRIRLKG       240
     KGASGERGGP AGDLYVVVHV SPHPVFGRED DNLTVTVPVT FPEAVLGADI QVPTLGGMPV       300
     TVKLPANSQN GRVLRVRGRG VARKDGTKGD LLVRFEIAVP AEIGDDARAA LQKFQEATGN       360
     HHPRAELLDS AKGE                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page