(data stored in ACNUC7421 zone)

EMBL: CP001700.PE84

CP001700.PE84        Location/Qualifiers
FT   CDS             86446..86916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0084"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: sma:SAV_4487 HspR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69039"
FT                   /db_xref="GOA:C7QHA0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA0"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACU69039.1"
FT                   /translation="MASKNPFLPLTEETPVYVISVAAQLAGMHPQTLRQYDRLGIVCPE
FT                   RTGGGGRRYSARDIDTLREVQRLSQDEGVNLAGIKRIRELEEQVAALSRRVAELEAVTL
FT                   YPTAKGTVPVAAPIAPPVSPLPPAPPGYRGDLLPALPATFTTALAVWKPQGK"
     MASKNPFLPL TEETPVYVIS VAAQLAGMHP QTLRQYDRLG IVCPERTGGG GRRYSARDID        60
     TLREVQRLSQ DEGVNLAGIK RIRELEEQVA ALSRRVAELE AVTLYPTAKG TVPVAAPIAP       120
     PVSPLPPAPP GYRGDLLPAL PATFTTALAV WKPQGK                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page