(data stored in ACNUC7421 zone)

EMBL: CP001700.PE85

CP001700.PE85        Location/Qualifiers
FT   CDS             87023..89641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0085"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="KEGG: tfu:Tfu_0200 ATPase; TIGRFAM: ATP-dependent
FT                   chaperone ClpB; PFAM: ATPase AAA-2 domain protein; AAA
FT                   ATPase central domain protein; ATPase associated with
FT                   various cellular activities AAA_5; Clp domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69040"
FT                   /db_xref="GOA:C7QHA1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA1"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ACU69040.1"
FT                   /translation="MDSQKLTTKSQEALSVAIREATRAGNPQVESIQVLLALLGQVEGT
FT                   TRPLLEAVGVDRAALSQAVTAAAERLPSASGSTVSAPTLARNTLNALNAAGDEARKLDD
FT                   EYVSTEHLLLGLALGNDSTADLLKKAGATPQALREAFGKVRGSARVTSQDPEATYQALE
FT                   KYGVDLTAAARDGKLDPVIGRDAEIRRVVQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQ
FT                   RIIAGDVPESLRDKRLVSLDLGAMVAGAKYRGEFEERLKAVLADIKDSEGQIVTFIDEL
FT                   HTVVGAGATGDSSMDAGNMLKPMLARGELRMVGATTLDEYRERIEKDPALERRFQQVLV
FT                   DEPTVEDTIAILRGLKGRYEAHHKVAISDTALVAAATLSHRYITSRFLPDKAIDLIDEA
FT                   ASRLRMEIDSRPVEIDELQRTVDRMKMEELALAKEHDPASRDRLARLRLDLADRQEQLN
FT                   ALNARWEQEKSGLNRVGELKQRLDAMKSQVEQAQRSGDFETASRLLYAEIPAVEAELET
FT                   ASTTVDEAEDVAPMVKEEVGPDDIAEVVGAWTGIPAGRLLEGETEKLLTMEQRIGERLI
FT                   GQAEAVAAVSDAVRRARAGISDPDRPTGSFLFLGPTGVGKTELAKALADFLFDDEHAMV
FT                   RIDMSEYSEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYSVVLLDEVEKAHPEIFDV
FT                   LLQVLDDGRLTDGQGRTVDFRNTILILTSNLGTSGFDLTVDEALDPVQARLDRRQRVDN
FT                   AVRAAFKPEFLNRLDAQVIFDPLGTTELGRIVDIQVRKLAARLADRRLGLEVTPGARDW
FT                   LAIAGYEPAFGARPLRRLVQSSIGDPLARRLLAGEIRDGDTVRVDVDIENDALIIGSQA
FT                   S"
     MDSQKLTTKS QEALSVAIRE ATRAGNPQVE SIQVLLALLG QVEGTTRPLL EAVGVDRAAL        60
     SQAVTAAAER LPSASGSTVS APTLARNTLN ALNAAGDEAR KLDDEYVSTE HLLLGLALGN       120
     DSTADLLKKA GATPQALREA FGKVRGSARV TSQDPEATYQ ALEKYGVDLT AAARDGKLDP       180
     VIGRDAEIRR VVQVLSRRTK NNPVLIGEPG VGKTAVVEGL AQRIIAGDVP ESLRDKRLVS       240
     LDLGAMVAGA KYRGEFEERL KAVLADIKDS EGQIVTFIDE LHTVVGAGAT GDSSMDAGNM       300
     LKPMLARGEL RMVGATTLDE YRERIEKDPA LERRFQQVLV DEPTVEDTIA ILRGLKGRYE       360
     AHHKVAISDT ALVAAATLSH RYITSRFLPD KAIDLIDEAA SRLRMEIDSR PVEIDELQRT       420
     VDRMKMEELA LAKEHDPASR DRLARLRLDL ADRQEQLNAL NARWEQEKSG LNRVGELKQR       480
     LDAMKSQVEQ AQRSGDFETA SRLLYAEIPA VEAELETAST TVDEAEDVAP MVKEEVGPDD       540
     IAEVVGAWTG IPAGRLLEGE TEKLLTMEQR IGERLIGQAE AVAAVSDAVR RARAGISDPD       600
     RPTGSFLFLG PTGVGKTELA KALADFLFDD EHAMVRIDMS EYSEKHSVAR LVGAPPGYVG       660
     YEEGGQLTEA VRRRPYSVVL LDEVEKAHPE IFDVLLQVLD DGRLTDGQGR TVDFRNTILI       720
     LTSNLGTSGF DLTVDEALDP VQARLDRRQR VDNAVRAAFK PEFLNRLDAQ VIFDPLGTTE       780
     LGRIVDIQVR KLAARLADRR LGLEVTPGAR DWLAIAGYEP AFGARPLRRL VQSSIGDPLA       840
     RRLLAGEIRD GDTVRVDVDI ENDALIIGSQ AS                                     872
//

If you have problems or comments...

PBIL Back to PBIL home page