(data stored in ACNUC7421 zone)

EMBL: CP001700.PE86

CP001700.PE86        Location/Qualifiers
FT   CDS             89681..90544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69041"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA2"
FT                   /inference="similar to AA sequence:KEGG:SGR_6214"
FT                   /protein_id="ACU69041.1"
FT                   /translation="MPAALPTVIATRYVTALREGGSLPGLVEAADLGTYVVKFRSAGQG
FT                   RKALVAEVIAGELARALALLVPALVGIELDPIIGAAEPDQEIQELLKGSKGLNLGMDYL
FT                   PGSLGYDPLAFPVEPELASRVVWFDALVRNVDRSWRNPNLLLWHRKLYLIDHGASLIFH
FT                   HNWPGAQKGALAPFDANDHVLASYAKDMPGADAALAPLVTEELLRSVVAVVPDEWLVDE
FT                   PGFDSADAVREAYVSYLLTRVVGPREWFPQVVDSSAQEAARAHEGSDLKARLKAKHPNW
FT                   MQGRVK"
     MPAALPTVIA TRYVTALREG GSLPGLVEAA DLGTYVVKFR SAGQGRKALV AEVIAGELAR        60
     ALALLVPALV GIELDPIIGA AEPDQEIQEL LKGSKGLNLG MDYLPGSLGY DPLAFPVEPE       120
     LASRVVWFDA LVRNVDRSWR NPNLLLWHRK LYLIDHGASL IFHHNWPGAQ KGALAPFDAN       180
     DHVLASYAKD MPGADAALAP LVTEELLRSV VAVVPDEWLV DEPGFDSADA VREAYVSYLL       240
     TRVVGPREWF PQVVDSSAQE AARAHEGSDL KARLKAKHPN WMQGRVK                     287
//

If you have problems or comments...

PBIL Back to PBIL home page