(data stored in ACNUC7421 zone)

EMBL: CP001700.PE87

CP001700.PE87        Location/Qualifiers
FT   CDS             90541..90918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO1348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69042"
FT                   /db_xref="InterPro:IPR021398"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA3"
FT                   /inference="similar to AA sequence:KEGG:SCO1348"
FT                   /protein_id="ACU69042.1"
FT                   /translation="MSVQPYEYSVLRAVPRVERGEYVNVGVVLYCQQLDFLGCATQLDS
FT                   VRVRALDPTADVEGIEALLGAVSKVCCGGPDSGPAGQDAMGRRFRWLIAPRSTVVQPGP
FT                   VHTGLTADPAAALDRLAGSLL"
     MSVQPYEYSV LRAVPRVERG EYVNVGVVLY CQQLDFLGCA TQLDSVRVRA LDPTADVEGI        60
     EALLGAVSKV CCGGPDSGPA GQDAMGRRFR WLIAPRSTVV QPGPVHTGLT ADPAAALDRL       120
     AGSLL                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page