(data stored in ACNUC7421 zone)

EMBL: CP001700.PE88

CP001700.PE88        Location/Qualifiers
FT   CDS             complement(90866..91813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0088"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: tfu:Tfu_1700 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69043"
FT                   /db_xref="GOA:C7QHA4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69043.1"
FT                   /translation="MGTWGPQGVSGKVVVITGAARGIGADAARRLARRGAKVALIGLEP
FT                   EELRKTAESCGPDATAWDADVTSWEQLGAAIDGIVDHYGGIDVVVANAGVAPTGFIRSI
FT                   DPSAFERTIEINLLGVWRTVRTALPHIIKNKGYVLVVSSAAALIHPPALAAYTASKAGA
FT                   EAFGDSLRAEVKHLGVDVGVAYFSWIKTDLVTSADAHPVLGKFRTSAPGPASRVYPLEK
FT                   VGQAVADGIAKRSRVICVPSWVNQLRRFHGMLPAIVEKANARATARADREMIADIEKRG
FT                   VEASSRLTGPGGAAAQAAKEAIQPVGRELPQDQR"
     MGTWGPQGVS GKVVVITGAA RGIGADAARR LARRGAKVAL IGLEPEELRK TAESCGPDAT        60
     AWDADVTSWE QLGAAIDGIV DHYGGIDVVV ANAGVAPTGF IRSIDPSAFE RTIEINLLGV       120
     WRTVRTALPH IIKNKGYVLV VSSAAALIHP PALAAYTASK AGAEAFGDSL RAEVKHLGVD       180
     VGVAYFSWIK TDLVTSADAH PVLGKFRTSA PGPASRVYPL EKVGQAVADG IAKRSRVICV       240
     PSWVNQLRRF HGMLPAIVEK ANARATARAD REMIADIEKR GVEASSRLTG PGGAAAQAAK       300
     EAIQPVGREL PQDQR                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page