(data stored in ACNUC7421 zone)

EMBL: CP001700.PE89

CP001700.PE89        Location/Qualifiers
FT   CDS             complement(91864..93579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0089"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; protein of unknown function RIO1;
FT                   aminoglycoside phosphotransferase; SMART: serine/threonine
FT                   protein kinase; tyrosine protein kinase; KEGG:
FT                   fre:Franean1_5221 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69044"
FT                   /db_xref="GOA:C7QHA5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU69044.1"
FT                   /translation="MTLDMNSDVHKGGSPATDRLGPYLLVTQLGSGAMGRVFLGTDSTG
FT                   RQAAVKVVRSDLADIPAFRKRFSRELNVAERVHSPRVAEIYDAQTEGKRPWLATEYVPG
FT                   PTLQDAVEQGGAFDNEHLRALAVAIAEALEVIHAAEVVHRDLKPANVLLGPDGPKVIDF
FT                   GVARALDASLLTNTGQTLGTPAYMSPEQADGRAVESASDVFALGSLLVFAATGRLAFGD
FT                   GAPLAILHRVVNNDPDLSGVAEDDEVLRGVIEGCLCKEPEDRPSPQQIKDTFGAIGWQP
FT                   LTGVAWQQPPLGVGLPLTAGDAADLPTVAIAPKRGTKRVAVISAATVAALILATIAVVE
FT                   ASGGGKGNTAADTARTGGPTSSSQQNGGAFPSTDTSSGSTSSSGQTTPTSSSPPPPSQA
FT                   SGAPVPPGGGAGSTAPPQGSSQLVTVSVPITQGNGGSSQKPAPTSSHPTTHPSSAHTTS
FT                   AAPPPPPTHNPPGPMVAGDISVLIPNWVGAATVNVSWKAHSDATSYAIHYTVKGTATNS
FT                   DQTVPVSGTSYSYQIPADGTTCLQVRTVNQYGSSAFYPSPMYCVNSFGQVSSGG"
     MTLDMNSDVH KGGSPATDRL GPYLLVTQLG SGAMGRVFLG TDSTGRQAAV KVVRSDLADI        60
     PAFRKRFSRE LNVAERVHSP RVAEIYDAQT EGKRPWLATE YVPGPTLQDA VEQGGAFDNE       120
     HLRALAVAIA EALEVIHAAE VVHRDLKPAN VLLGPDGPKV IDFGVARALD ASLLTNTGQT       180
     LGTPAYMSPE QADGRAVESA SDVFALGSLL VFAATGRLAF GDGAPLAILH RVVNNDPDLS       240
     GVAEDDEVLR GVIEGCLCKE PEDRPSPQQI KDTFGAIGWQ PLTGVAWQQP PLGVGLPLTA       300
     GDAADLPTVA IAPKRGTKRV AVISAATVAA LILATIAVVE ASGGGKGNTA ADTARTGGPT       360
     SSSQQNGGAF PSTDTSSGST SSSGQTTPTS SSPPPPSQAS GAPVPPGGGA GSTAPPQGSS       420
     QLVTVSVPIT QGNGGSSQKP APTSSHPTTH PSSAHTTSAA PPPPPTHNPP GPMVAGDISV       480
     LIPNWVGAAT VNVSWKAHSD ATSYAIHYTV KGTATNSDQT VPVSGTSYSY QIPADGTTCL       540
     QVRTVNQYGS SAFYPSPMYC VNSFGQVSSG G                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page