(data stored in ACNUC7421 zone)

EMBL: CP001700.PE9

CP001700.PE9         Location/Qualifiers
FT   CDS             complement(13602..14144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_4895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68964"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68964.1"
FT                   /translation="MSAVQIAGCSAAGKSAIATALAHQGLTTIDSDADPHLARFVDPQG
FT                   TIVAQPPPAPDLPWLAEHSWAWDPNRLDELIQTAAPATLYVCGGADNQHEMANRFTQVF
FT                   LLEIDEPTMLARLDARRDYHEWGHVGDTREYLRRKLPILQDTLRASGAIVIDARQPLDQ
FT                   VVAAVLRYTPPMAPFSF"
     MSAVQIAGCS AAGKSAIATA LAHQGLTTID SDADPHLARF VDPQGTIVAQ PPPAPDLPWL        60
     AEHSWAWDPN RLDELIQTAA PATLYVCGGA DNQHEMANRF TQVFLLEIDE PTMLARLDAR       120
     RDYHEWGHVG DTREYLRRKL PILQDTLRAS GAIVIDARQP LDQVVAAVLR YTPPMAPFSF       180
//

If you have problems or comments...

PBIL Back to PBIL home page