(data stored in ACNUC7421 zone)

EMBL: CP001700.PE90

CP001700.PE90        Location/Qualifiers
FT   CDS             complement(93643..94437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0090"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: sma:SAV_4383 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69045"
FT                   /db_xref="GOA:C7QHA6"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA6"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACU69045.1"
FT                   /translation="MRVSLMQLAVDDAEAPEDRWTRVVKLVEAERETGAELVVLPELWV
FT                   TGGFDYKSWTGHAEPIADSQPIAALEKVRTHDGSGPEMWLHFGSYVERTPEGILYNTAV
FT                   FRGPDGKQAQYRKIHRFGFSEGEVTLMGPGKDIVTVSSPWGTLGLATCYDLRFPELFRR
FT                   LLNQGMEHMVMCSAWPAKRIEHWRVLLKARAIENQVFVFATNCVGTNGGVALGGRSAVI
FT                   DPWGNVVAEAGTGEEVLRVDVDPALVAQTRSALPVLNDRRLR"
     MRVSLMQLAV DDAEAPEDRW TRVVKLVEAE RETGAELVVL PELWVTGGFD YKSWTGHAEP        60
     IADSQPIAAL EKVRTHDGSG PEMWLHFGSY VERTPEGILY NTAVFRGPDG KQAQYRKIHR       120
     FGFSEGEVTL MGPGKDIVTV SSPWGTLGLA TCYDLRFPEL FRRLLNQGME HMVMCSAWPA       180
     KRIEHWRVLL KARAIENQVF VFATNCVGTN GGVALGGRSA VIDPWGNVVA EAGTGEEVLR       240
     VDVDPALVAQ TRSALPVLND RRLR                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page