(data stored in ACNUC7421 zone)

EMBL: CP001700.PE91

CP001700.PE91        Location/Qualifiers
FT   CDS             complement(94534..96027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0091"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   sco:SCO3815 branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69046"
FT                   /db_xref="GOA:C7QHA7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA7"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ACU69046.1"
FT                   /translation="MGEIKRFNLPDVGEGLTEAEILAWSVKVGDLVKVNQVLVEIETAK
FT                   AAVELPSPWAGKIVELLVDEGQTVDVGTPIIGIDTDPSTPSTGGAGGDDMTAGVAATAE
FT                   AKAAPAAAKEPKEAKREPVLVGYGVKQGASSRRPRKTAAAPSAADVMGATVREEPVADE
FT                   VPAPAYYGQSAAREAAAPAVQTRTPDTTAAPAAPTGAKPLAKPPVRKLAKDLGVDLALV
FT                   VATGTNGTVTREDVHAAASGTSTAAAAPAAANGTAPAAAPFVNGERRVPIKGVRKATAT
FT                   AMVQSAFTAPHVTEFLTVDVTPTMKFVQRLKEMPDFKGVRVSPLLLVAKAFLVAMARNP
FT                   EINARWDEAAGEIVYFDHVTLGIAAATPRGLLVPNVKGADLLPLVELGRALNKLTDVAR
FT                   EGKTSLADMTGATATITNVGVFGVDTGTPILNPGEASILAFGAVREQPWMHKGKVKPRQ
FT                   VTTLALSFDHRLVDGELGSKVLRDIGAVLADPLTALAWS"
     MGEIKRFNLP DVGEGLTEAE ILAWSVKVGD LVKVNQVLVE IETAKAAVEL PSPWAGKIVE        60
     LLVDEGQTVD VGTPIIGIDT DPSTPSTGGA GGDDMTAGVA ATAEAKAAPA AAKEPKEAKR       120
     EPVLVGYGVK QGASSRRPRK TAAAPSAADV MGATVREEPV ADEVPAPAYY GQSAAREAAA       180
     PAVQTRTPDT TAAPAAPTGA KPLAKPPVRK LAKDLGVDLA LVVATGTNGT VTREDVHAAA       240
     SGTSTAAAAP AAANGTAPAA APFVNGERRV PIKGVRKATA TAMVQSAFTA PHVTEFLTVD       300
     VTPTMKFVQR LKEMPDFKGV RVSPLLLVAK AFLVAMARNP EINARWDEAA GEIVYFDHVT       360
     LGIAAATPRG LLVPNVKGAD LLPLVELGRA LNKLTDVARE GKTSLADMTG ATATITNVGV       420
     FGVDTGTPIL NPGEASILAF GAVREQPWMH KGKVKPRQVT TLALSFDHRL VDGELGSKVL       480
     RDIGAVLADP LTALAWS                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page