(data stored in ACNUC7421 zone)

EMBL: CP001700.PE92

CP001700.PE92        Location/Qualifiers
FT   CDS             complement(96046..97041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0092"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: sco:SCO3816 branched-chain alpha keto
FT                   acid dehydrogenase E1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69047"
FT                   /db_xref="GOA:C7QHA8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA8"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACU69047.1"
FT                   /translation="MAESTSKTQQISLGKGLNLGLRRALEDDPKVLLMGEDIGKLGGVF
FT                   RVTDGLQKDFGDSRVIDTPLAESGIVGTAVGLALSGYRPVVEIQFDGFVYPAFDQIVTQ
FT                   VAKMRARALGTVSMPIVIRIPFGGGIGAVEHHSESPEGYFAMTAGLRVVAASNPVDAYW
FT                   MIQQAIASDDPVVFFEPKRRYWDKAELDPAATPYPLYASRVVREGTDATLVAYGPMVKT
FT                   CLEAAAAAAEEGRSLEVIDLRTLSPLDLEPVYASVRKTGRLITVHEASVFMGMGAEVAA
FT                   KVTEKCFYSLEAPVLRVGAPHTPYPPSRVEEEFLPDLDRVLDAVDRAFAF"
     MAESTSKTQQ ISLGKGLNLG LRRALEDDPK VLLMGEDIGK LGGVFRVTDG LQKDFGDSRV        60
     IDTPLAESGI VGTAVGLALS GYRPVVEIQF DGFVYPAFDQ IVTQVAKMRA RALGTVSMPI       120
     VIRIPFGGGI GAVEHHSESP EGYFAMTAGL RVVAASNPVD AYWMIQQAIA SDDPVVFFEP       180
     KRRYWDKAEL DPAATPYPLY ASRVVREGTD ATLVAYGPMV KTCLEAAAAA AEEGRSLEVI       240
     DLRTLSPLDL EPVYASVRKT GRLITVHEAS VFMGMGAEVA AKVTEKCFYS LEAPVLRVGA       300
     PHTPYPPSRV EEEFLPDLDR VLDAVDRAFA F                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page