(data stored in ACNUC7421 zone)

EMBL: CP001700.PE93

CP001700.PE93        Location/Qualifiers
FT   CDS             complement(97043..98170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0093"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: sgr:SGR_3765 putative branched-chain alpha
FT                   keto acid dehydrogenase E1 alpha subunit; TIGRFAM: pyruvate
FT                   dehydrogenase (acetyl- transferring) E1 component, alpha
FT                   subunit; PFAM: dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69048"
FT                   /db_xref="GOA:C7QHA9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA9"
FT                   /inference="protein motif:TFAM:TIGR03181"
FT                   /protein_id="ACU69048.1"
FT                   /translation="MVTSRKGAGGKTAAKKKAGPADPDLVQLLTPDGDLVEHPEYSIDL
FT                   TPEEYRGLYRDMVLVRRIDAEGTALQRQGELGLWAPLLGQEAAQVGSGRAQTAEDYAFP
FT                   TYREHGVAWCRDVDPVNLLGMFRGVNNGGWDPNEKNFHLYTIVIGSQTLHATGYAMGMQ
FT                   RDGREAAVIAYFGDGASSQGDVNEAFVFASVNNAPVVFFCQNNQWAISEPNERQFRVPL
FT                   YQRAAGFGFPGVRVDGNDVLACLAVTRAALERARTGNGPMLVEAFTYRMGAHTTSDDPT
FT                   RYRSSDELEEWKAKDPILRMRAFLEKSKYADEAFFKEVDTEADTVAADIRERCVTMPDP
FT                   KPISIFDHVYAEPHPLMDEERAEYGAYWESFEGAH"
     MVTSRKGAGG KTAAKKKAGP ADPDLVQLLT PDGDLVEHPE YSIDLTPEEY RGLYRDMVLV        60
     RRIDAEGTAL QRQGELGLWA PLLGQEAAQV GSGRAQTAED YAFPTYREHG VAWCRDVDPV       120
     NLLGMFRGVN NGGWDPNEKN FHLYTIVIGS QTLHATGYAM GMQRDGREAA VIAYFGDGAS       180
     SQGDVNEAFV FASVNNAPVV FFCQNNQWAI SEPNERQFRV PLYQRAAGFG FPGVRVDGND       240
     VLACLAVTRA ALERARTGNG PMLVEAFTYR MGAHTTSDDP TRYRSSDELE EWKAKDPILR       300
     MRAFLEKSKY ADEAFFKEVD TEADTVAADI RERCVTMPDP KPISIFDHVY AEPHPLMDEE       360
     RAEYGAYWES FEGAH                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page