(data stored in ACNUC7421 zone)

EMBL: CP001700.PE94

CP001700.PE94        Location/Qualifiers
FT   CDS             98378..99079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0094"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   ace:Acel_0518 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69049"
FT                   /db_xref="GOA:C7QHB0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69049.1"
FT                   /translation="MHSDAGKPGIPDSIRVFLLDDHELVRRGVAEMLSAEPDIDVTGQA
FT                   GSVAQTVAAAEAARPDVALLDVRLPDGSGIEVCRELKSRMPGLGCLMLTSFSDDDALFG
FT                   AIMAGAAGYVLKDIRGSALVDAVRTVARGGSLLDPTATEKLLSRLRVGIVPGEADREAA
FT                   ASKLATLTVSEKRILELIAEGLTNRQIGERLNLAEKTVKNYITGILAKLAMQRRTQAAA
FT                   FAVRHLPGRSQ"
     MHSDAGKPGI PDSIRVFLLD DHELVRRGVA EMLSAEPDID VTGQAGSVAQ TVAAAEAARP        60
     DVALLDVRLP DGSGIEVCRE LKSRMPGLGC LMLTSFSDDD ALFGAIMAGA AGYVLKDIRG       120
     SALVDAVRTV ARGGSLLDPT ATEKLLSRLR VGIVPGEADR EAAASKLATL TVSEKRILEL       180
     IAEGLTNRQI GERLNLAEKT VKNYITGILA KLAMQRRTQA AAFAVRHLPG RSQ              233
//

If you have problems or comments...

PBIL Back to PBIL home page