(data stored in ACNUC7421 zone)

EMBL: CP001700.PE95

CP001700.PE95        Location/Qualifiers
FT   CDS             complement(99127..99723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0095"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO1339
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69050"
FT                   /db_xref="GOA:C7QHB1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69050.1"
FT                   /translation="MTSRPDLIGDTAIALLAERGLRGLTHRAVDEAAGLPPGSTSNHAR
FT                   TRSALLETTFARLCRLEAEIFEDAANPGGLLALATLTPETAADLVAAQLHDTLTHRREQ
FT                   ALARFELALEATRRPELRAIYDTAGATFREPARGLMAALGATDPDRAGRSFIAFSEGIL
FT                   FDSVAGAGSRKVPTQEEIRDDLLELFRGMLMEPSP"
     MTSRPDLIGD TAIALLAERG LRGLTHRAVD EAAGLPPGST SNHARTRSAL LETTFARLCR        60
     LEAEIFEDAA NPGGLLALAT LTPETAADLV AAQLHDTLTH RREQALARFE LALEATRRPE       120
     LRAIYDTAGA TFREPARGLM AALGATDPDR AGRSFIAFSE GILFDSVAGA GSRKVPTQEE       180
     IRDDLLELFR GMLMEPSP                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page