(data stored in ACNUC7421 zone)

EMBL: CP001700.PE96

CP001700.PE96        Location/Qualifiers
FT   CDS             99812..100978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0096"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: sco:SCO1338
FT                   monooxygenase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69051"
FT                   /db_xref="GOA:C7QHB2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB2"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACU69051.1"
FT                   /translation="MEAIVVGAGFGGLTAAVGLFQRGWDVTVVERATELRPVGSGLAVA
FT                   PNGLRALDTLGVGDAVRKLAAFQGDATVTRPDGRVIARTASKAIVRRFGDAVIPATRSS
FT                   VMDVLTALVPADVFRLGVAAQGVEAGSASQRPCLLTDSGRLEADMIVAADGVNSVLRRA
FT                   LFPEHPGAVYSGITAWRLLVPTPAGDFLPGEVWGGGRVFGITPLADGRTYAYGADHAEP
FT                   GITYPDEKAELLRRFGDWHFPIPALISGADPETVLHNDIYEIAEALPAYHRGSVAILGD
FT                   AAHAMTPHLGQGANQAMEDGVTLAALVGPAKDSEEIASALARYTALRALRGADMVRRSH
FT                   RMGALTQSTSRSKTALRNLGMSLVGRLVPDLALRAMEPVVAWRPPEGP"
     MEAIVVGAGF GGLTAAVGLF QRGWDVTVVE RATELRPVGS GLAVAPNGLR ALDTLGVGDA        60
     VRKLAAFQGD ATVTRPDGRV IARTASKAIV RRFGDAVIPA TRSSVMDVLT ALVPADVFRL       120
     GVAAQGVEAG SASQRPCLLT DSGRLEADMI VAADGVNSVL RRALFPEHPG AVYSGITAWR       180
     LLVPTPAGDF LPGEVWGGGR VFGITPLADG RTYAYGADHA EPGITYPDEK AELLRRFGDW       240
     HFPIPALISG ADPETVLHND IYEIAEALPA YHRGSVAILG DAAHAMTPHL GQGANQAMED       300
     GVTLAALVGP AKDSEEIASA LARYTALRAL RGADMVRRSH RMGALTQSTS RSKTALRNLG       360
     MSLVGRLVPD LALRAMEPVV AWRPPEGP                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page