(data stored in ACNUC7421 zone)

EMBL: CP001700.PE97

CP001700.PE97        Location/Qualifiers
FT   CDS             100989..101933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0097"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ace:Acel_2105 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69052"
FT                   /db_xref="GOA:C7QHB3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB3"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACU69052.1"
FT                   /translation="MTDTASPRVPTRYGFLGPAGTFTEAALLSVPGARDAERVPYESVP
FT                   AALDAVRRDEVAGAVVAFENSVEGAVPATLDDLSTEEPPLHIVREILLPVEFALMGRPD
FT                   TALADIKTVSSHPHAYPQCRRWLAENLPDARWVAASSNADAARLVSEGVHDAALAGSFA
FT                   APFYRLTLLAENIHDVSGAVTRFVMVVPPGPPPARTGADKTSLAVVLRDNHPGALLEIL
FT                   EEFAVRGVDLMRIESRPTRSKLGTYWFSIDCEGHLEDARVGEVLTGLRRVAAEVRYLGS
FT                   YPRADGRAAEIRKGTSDEDFHEAAEWLAGLRNR"
     MTDTASPRVP TRYGFLGPAG TFTEAALLSV PGARDAERVP YESVPAALDA VRRDEVAGAV        60
     VAFENSVEGA VPATLDDLST EEPPLHIVRE ILLPVEFALM GRPDTALADI KTVSSHPHAY       120
     PQCRRWLAEN LPDARWVAAS SNADAARLVS EGVHDAALAG SFAAPFYRLT LLAENIHDVS       180
     GAVTRFVMVV PPGPPPARTG ADKTSLAVVL RDNHPGALLE ILEEFAVRGV DLMRIESRPT       240
     RSKLGTYWFS IDCEGHLEDA RVGEVLTGLR RVAAEVRYLG SYPRADGRAA EIRKGTSDED       300
     FHEAAEWLAG LRNR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page