(data stored in ACNUC7421 zone)

EMBL: CP001700.PE98

CP001700.PE98        Location/Qualifiers
FT   CDS             complement(101920..102750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69053"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB4"
FT                   /inference="similar to AA sequence:KEGG:SAV_4347"
FT                   /protein_id="ACU69053.1"
FT                   /translation="METAQAMSEPLFQNLEDAVVVAETALLDTQVAVESLRAELDQFTR
FT                   LHQIQLGPLYGRLDELDALTAETEAAMTGDPEAIRRAVEARARVDGEDPMLFAAANAGL
FT                   LEDDGEGGSEHEQKPPRPREEAAPTPDPDVPVRPSKTAQRLYRELARRSHPDLVQDQAE
FT                   IARRSAFITRVNAAYEKDDLPALQKLSEEWSLTSSGPAVDSPQREMWLQHRLIWLRVKQ
FT                   AELALERQTLMENPMADVLAAYQYDSLTALRSISEQLYTAIAERETLLNALIGS"
     METAQAMSEP LFQNLEDAVV VAETALLDTQ VAVESLRAEL DQFTRLHQIQ LGPLYGRLDE        60
     LDALTAETEA AMTGDPEAIR RAVEARARVD GEDPMLFAAA NAGLLEDDGE GGSEHEQKPP       120
     RPREEAAPTP DPDVPVRPSK TAQRLYRELA RRSHPDLVQD QAEIARRSAF ITRVNAAYEK       180
     DDLPALQKLS EEWSLTSSGP AVDSPQREMW LQHRLIWLRV KQAELALERQ TLMENPMADV       240
     LAAYQYDSLT ALRSISEQLY TAIAERETLL NALIGS                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page