(data stored in ACNUC7421 zone)

EMBL: CP001700.PE99

CP001700.PE99        Location/Qualifiers
FT   CDS             102850..103614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0099"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: fal:FRAAL4906
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69054"
FT                   /db_xref="GOA:C7QHB5"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB5"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ACU69054.1"
FT                   /translation="MIDLNADLGEGFGRWRLGDDDALLELVTSANVACGFHAGDPSTMR
FT                   RVCAAAVSRGVRVGAQVGYRDLAGFGRRDIEYDPHELADDVLFQIGALDAFARAAGDRV
FT                   RYVKPHGALYNRIVHDAVQAEAVVRAVVTFASVYDVQVPVLGLPGSVFLELATTAGLSV
FT                   IPEAFADRAYTPQGTLVSRSKPGAVLTTPEEVAGRAVEMAVSGTVRAIDGTLVNVSARS
FT                   LCVHGDSPSAVAMAAAVRDGLRSVGVEVGAFA"
     MIDLNADLGE GFGRWRLGDD DALLELVTSA NVACGFHAGD PSTMRRVCAA AVSRGVRVGA        60
     QVGYRDLAGF GRRDIEYDPH ELADDVLFQI GALDAFARAA GDRVRYVKPH GALYNRIVHD       120
     AVQAEAVVRA VVTFASVYDV QVPVLGLPGS VFLELATTAG LSVIPEAFAD RAYTPQGTLV       180
     SRSKPGAVLT TPEEVAGRAV EMAVSGTVRA IDGTLVNVSA RSLCVHGDSP SAVAMAAAVR       240
     DGLRSVGVEV GAFA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page