(data stored in ACNUC7421 zone)

EMBL: CP001720.PE1

CP001720.PE1         Location/Qualifiers
FT   CDS             31..1371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bsu:BSU00010 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60966"
FT                   /db_xref="GOA:C8VV97"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C8VV97"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACV60966.1"
FT                   /translation="MKNTNVKNIWEELLISIKNKVSQQSYDLWINSLNPIGLHNNVLTI
FT                   EVSDNFTKDWINDRYYPLLKSNLRNVLKTDTDIQFILAAEVENYLSQHSLEKVEEAKED
FT                   IEYNTNHIKSKYTFDTFVVGDSNRFAHAACFAVAESPAKSYNPLFIYGGVGLGKTHLMH
FT                   AIAHYILTQGTGSKVVYVTSEKFTNELINSFRDDQTIKFRNKYRSMNILLIDDIQFLAG
FT                   KERTQEEFFHTFNTLYEANKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQAPDYET
FT                   RIAILRKKAQVDKLYIPDEVINFIATKIKSNIRELEGCLIRIIAYASFTKKEMNVELAE
FT                   QVLKDILNPKTKQITVELIQKSIAEHFEIKSEELKAKNRSRTISHPRQIAMYLARELTD
FT                   LSLPKIGEAFGGRDHTTVLHAHEKIKEQIKKDGKLENTLKELINKLQ"
     MKNTNVKNIW EELLISIKNK VSQQSYDLWI NSLNPIGLHN NVLTIEVSDN FTKDWINDRY        60
     YPLLKSNLRN VLKTDTDIQF ILAAEVENYL SQHSLEKVEE AKEDIEYNTN HIKSKYTFDT       120
     FVVGDSNRFA HAACFAVAES PAKSYNPLFI YGGVGLGKTH LMHAIAHYIL TQGTGSKVVY       180
     VTSEKFTNEL INSFRDDQTI KFRNKYRSMN ILLIDDIQFL AGKERTQEEF FHTFNTLYEA       240
     NKQIIISSDR PPKEIPTLED RLRSRFEWGL ITDIQAPDYE TRIAILRKKA QVDKLYIPDE       300
     VINFIATKIK SNIRELEGCL IRIIAYASFT KKEMNVELAE QVLKDILNPK TKQITVELIQ       360
     KSIAEHFEIK SEELKAKNRS RTISHPRQIA MYLARELTDL SLPKIGEAFG GRDHTTVLHA       420
     HEKIKEQIKK DGKLENTLKE LINKLQ                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page