(data stored in ACNUC7421 zone)

EMBL: CP001720.PE100

CP001720.PE100       Location/Qualifiers
FT   CDS             110954..111766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0102"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: baa:BA_0620
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61065"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q9"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ACV61065.1"
FT                   /translation="MPYKVVGVRFKKAGKIYFFEPDGFELSEGDNVIVETARGIEFGQV
FT                   VSESMEVAEEDIVQPLKKVIRKAEKEDMDQIEINQEKEVRAFQVAEEKIAKHNLPMKLV
FT                   NVEQTFDGNKIIFYFTADGRIDFRELVKDLAGVFRTRIELRQIGVRDEAKMIGGLGCCG
FT                   RELCCCSWLSDFVSVSIRMAKEQNLSLNPTKISGICGRLMCCLKYENELYEQERENFPE
FT                   AGSRVISPDGEGKVTGRNIFKRTVSVELKESKIIKSYPINEVTFKNKE"
     MPYKVVGVRF KKAGKIYFFE PDGFELSEGD NVIVETARGI EFGQVVSESM EVAEEDIVQP        60
     LKKVIRKAEK EDMDQIEINQ EKEVRAFQVA EEKIAKHNLP MKLVNVEQTF DGNKIIFYFT       120
     ADGRIDFREL VKDLAGVFRT RIELRQIGVR DEAKMIGGLG CCGRELCCCS WLSDFVSVSI       180
     RMAKEQNLSL NPTKISGICG RLMCCLKYEN ELYEQERENF PEAGSRVISP DGEGKVTGRN       240
     IFKRTVSVEL KESKIIKSYP INEVTFKNKE                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page