(data stored in ACNUC7421 zone)

EMBL: CP001720.PE101

CP001720.PE101       Location/Qualifiers
FT   CDS             111772..112107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0103"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972; KEGG:
FT                   bsu:BSU00330 DNA replication intiation control protein
FT                   YabA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61066"
FT                   /db_xref="GOA:C8W2R0"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R0"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ACV61066.1"
FT                   /translation="MLSLAQLMKRSQEKLQELSRDIQELSVRVYALEEENANLRRELAL
FT                   SCYNSEQVNNSAAGDREDVGIGLKNLITIYDRGFHICNLSFGLERSNDCLFCQALLQKS
FT                   GAEQKNT"
     MLSLAQLMKR SQEKLQELSR DIQELSVRVY ALEEENANLR RELALSCYNS EQVNNSAAGD        60
     REDVGIGLKN LITIYDRGFH ICNLSFGLER SNDCLFCQAL LQKSGAEQKN T                111
//

If you have problems or comments...

PBIL Back to PBIL home page