(data stored in ACNUC7421 zone)

EMBL: CP001720.PE104

CP001720.PE104       Location/Qualifiers
FT   CDS             114182..115783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0106"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M); aminoacyl-tRNA synthetase class Ia;
FT                   KEGG: bha:BH0053 methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61069"
FT                   /db_xref="GOA:C8W2R3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R3"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ACV61069.1"
FT                   /translation="MSKPTFYISTPIYYPSDKLHIGHAYTTVAADSFARYKRMKGYDVW
FT                   FLTGSDEHGQKIERTAKEKGQSPLEYVDQIVAGFKSLWKKLDVSYDDFIRTTQERHKKV
FT                   VQDIFQKLYDQGDIYKAQYEGHYCTPCETFWTEYQLDADGNCPDCGRPVEILQEESYFF
FT                   KMSKYADEILKYIEDNAEFIQPNSRRNEMVSFIKSGLADLCVSRTTFDWGIQVPFDPKH
FT                   VIYVWVDALTNYISALGYGTGDDSLFRKYWPADMHLVGKDIVRFHTIIWPIMLMAAGIE
FT                   LPKQVLGHGWLLLDSGKMSKSKGNVVDPLELCDKYGVDAIRYYLLRELPLGSDGYYSEE
FT                   ALVNRINIDLANDLGNLISRSTSMIVKFSKGVLEEPETPREPVLLEQYLGSEEAPAEDR
FT                   DLISLALKTKYEVDDLMERRDISGALAAVWRLVGRANKYVEETSPWSLAKDPELRGRLA
FT                   TVLYNLAETIRFVTVMVTPFMPNFPSMVWQQLAIGNQPELHVWEALEWGNLPAGTRVVK
FT                   GDAIFPRIDLKTLEKE"
     MSKPTFYIST PIYYPSDKLH IGHAYTTVAA DSFARYKRMK GYDVWFLTGS DEHGQKIERT        60
     AKEKGQSPLE YVDQIVAGFK SLWKKLDVSY DDFIRTTQER HKKVVQDIFQ KLYDQGDIYK       120
     AQYEGHYCTP CETFWTEYQL DADGNCPDCG RPVEILQEES YFFKMSKYAD EILKYIEDNA       180
     EFIQPNSRRN EMVSFIKSGL ADLCVSRTTF DWGIQVPFDP KHVIYVWVDA LTNYISALGY       240
     GTGDDSLFRK YWPADMHLVG KDIVRFHTII WPIMLMAAGI ELPKQVLGHG WLLLDSGKMS       300
     KSKGNVVDPL ELCDKYGVDA IRYYLLRELP LGSDGYYSEE ALVNRINIDL ANDLGNLISR       360
     STSMIVKFSK GVLEEPETPR EPVLLEQYLG SEEAPAEDRD LISLALKTKY EVDDLMERRD       420
     ISGALAAVWR LVGRANKYVE ETSPWSLAKD PELRGRLATV LYNLAETIRF VTVMVTPFMP       480
     NFPSMVWQQL AIGNQPELHV WEALEWGNLP AGTRVVKGDA IFPRIDLKTL EKE              533
//

If you have problems or comments...

PBIL Back to PBIL home page