(data stored in ACNUC7421 zone)

EMBL: CP001720.PE106

CP001720.PE106       Location/Qualifiers
FT   CDS             116606..117145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0108"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: scl:sce0214 cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61071"
FT                   /db_xref="GOA:C8W2R5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R5"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ACV61071.1"
FT                   /translation="MSEKNARGLIMTFTGNGKGKTTAALGMALRALGQGMRVIVLQFIK
FT                   GGREYGELLMEEKLGPNFEIRQMGLGFVRNLSEQQKEQHKQAAIEALGLAAQIIGSDKY
FT                   RMVILDEVFYGIKYGFFTISDLLELLRSKPYDLHLVLTGRDAPEEIIVLSDLVTEMKEI
FT                   KHPYKQGIVAQKGVEF"
     MSEKNARGLI MTFTGNGKGK TTAALGMALR ALGQGMRVIV LQFIKGGREY GELLMEEKLG        60
     PNFEIRQMGL GFVRNLSEQQ KEQHKQAAIE ALGLAAQIIG SDKYRMVILD EVFYGIKYGF       120
     FTISDLLELL RSKPYDLHLV LTGRDAPEEI IVLSDLVTEM KEIKHPYKQG IVAQKGVEF        179
//

If you have problems or comments...

PBIL Back to PBIL home page