(data stored in ACNUC7421 zone)

EMBL: CP001720.PE109

CP001720.PE109       Location/Qualifiers
FT   CDS             118923..119840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0111"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: baa:BA_0629 ribosomal RNA adenine dimethylase;
FT                   TIGRFAM: dimethyladenosine transferase; PFAM: ribosomal RNA
FT                   adenine methylase transferase; SMART: ribosomal RNA adenine
FT                   methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61074"
FT                   /db_xref="GOA:C8W2R8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R8"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACV61074.1"
FT                   /translation="MSELSSPSKVFNLFKEFNFHTNKKLGQNFLIDSNIISKIISAADL
FT                   RSEDLVVEIGPGLGVLTQSIADEVSRVLSIEIDRKLQPILEVNLKEYSNTKVIFQDALK
FT                   TDFDRLVYAEAGGKSRSYKVIANLPYYITTPLLMHILESKFNVELIVIMVQREVAERMT
FT                   APPGKKDYGALSVAVQYYTEPEIICRVPKTVFIPAPEVDSTVIRLIKRKLPPVQLKSEK
FT                   LFFNLVRTAFNQRRKTVLNAMQGSNWGLMKEEWKIILEKAGIDPMRRGETFSLQDFAML
FT                   SNCVYETLKELSTVYQEGEQIPLY"
     MSELSSPSKV FNLFKEFNFH TNKKLGQNFL IDSNIISKII SAADLRSEDL VVEIGPGLGV        60
     LTQSIADEVS RVLSIEIDRK LQPILEVNLK EYSNTKVIFQ DALKTDFDRL VYAEAGGKSR       120
     SYKVIANLPY YITTPLLMHI LESKFNVELI VIMVQREVAE RMTAPPGKKD YGALSVAVQY       180
     YTEPEIICRV PKTVFIPAPE VDSTVIRLIK RKLPPVQLKS EKLFFNLVRT AFNQRRKTVL       240
     NAMQGSNWGL MKEEWKIILE KAGIDPMRRG ETFSLQDFAM LSNCVYETLK ELSTVYQEGE       300
     QIPLY                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page