(data stored in ACNUC7421 zone)

EMBL: CP001720.PE114

CP001720.PE114       Location/Qualifiers
FT   CDS             complement(123831..124628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0116"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   sfu:Sfum_3174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61079"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S3"
FT                   /inference="protein motif:PFAM:PF02596"
FT                   /protein_id="ACV61079.1"
FT                   /translation="MKSKIAEAIGLKTKPVAILLSNAKPEDAMQFKEGRWGCVAAMFTA
FT                   AAMKGKSAVFDRKTYGCPGGGVGLGFGNLYLDFPGGFDYFLSIGNPEFCNTELGKNIVR
FT                   IMQSLKDGEAYKKTPELVKSFVDWLPITEVPAEYVIFKPLSEVKEDETPEVVTFLVTAD
FT                   QLSAMVVLANYDRKGSENVMIPFAAGCHNFFLVPYNEGKSDLPRAVVGMTDISVRKHMP
FT                   KDMLSFAMPYKRFLEMEDNVEGSFLQRHCWLEVLPRNNSGDEK"
     MKSKIAEAIG LKTKPVAILL SNAKPEDAMQ FKEGRWGCVA AMFTAAAMKG KSAVFDRKTY        60
     GCPGGGVGLG FGNLYLDFPG GFDYFLSIGN PEFCNTELGK NIVRIMQSLK DGEAYKKTPE       120
     LVKSFVDWLP ITEVPAEYVI FKPLSEVKED ETPEVVTFLV TADQLSAMVV LANYDRKGSE       180
     NVMIPFAAGC HNFFLVPYNE GKSDLPRAVV GMTDISVRKH MPKDMLSFAM PYKRFLEMED       240
     NVEGSFLQRH CWLEVLPRNN SGDEK                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page