(data stored in ACNUC7421 zone)

EMBL: CP001720.PE12

CP001720.PE12        Location/Qualifiers
FT   CDS             16460..16975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yps:YPTB1690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60977"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60977.1"
FT                   /translation="MAETFIGFHGTTAENAKEIIKTRYFKYSMDDEEWLGEGVYFFEKD
FT                   IKQAYYYCVKAKKYTNWTILKSKIVCNVFWDLTLTDHVEEFQKIAKLFKDRYHKRKDGR
FT                   PRKLMNAVVFNAMYKLKPFDIIRAPFPVPKGYVVQRTNIVPIHIQLCVRNSECICKDSI
FT                   EEVSYNGH"
     MAETFIGFHG TTAENAKEII KTRYFKYSMD DEEWLGEGVY FFEKDIKQAY YYCVKAKKYT        60
     NWTILKSKIV CNVFWDLTLT DHVEEFQKIA KLFKDRYHKR KDGRPRKLMN AVVFNAMYKL       120
     KPFDIIRAPF PVPKGYVVQR TNIVPIHIQL CVRNSECICK DSIEEVSYNG H                171
//

If you have problems or comments...

PBIL Back to PBIL home page