(data stored in ACNUC7421 zone)

EMBL: CP001720.PE120

CP001720.PE120       Location/Qualifiers
FT   CDS             130296..130946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61085"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61085.1"
FT                   /translation="MSGDLYLTPRQKRVVQFIAATGNVSLMRHHTGVTRQDIKKMLEIT
FT                   DNRDLEAFIKVCNLVLKEETVPAQVLYDDILNRYVYVQTVDPVVLLDRIPVKTLLLFLF
FT                   MYYQQRALGHPQTRLLDLLEIVDSSLVENPRQKVLAALKPLLDYNLVKEDDEIYRVTKI
FT                   GDAFMTPLFLKKMTDVTLNKNYDLDVILEFYRKVIPRPEELGAEATDYQLSLF"
     MSGDLYLTPR QKRVVQFIAA TGNVSLMRHH TGVTRQDIKK MLEITDNRDL EAFIKVCNLV        60
     LKEETVPAQV LYDDILNRYV YVQTVDPVVL LDRIPVKTLL LFLFMYYQQR ALGHPQTRLL       120
     DLLEIVDSSL VENPRQKVLA ALKPLLDYNL VKEDDEIYRV TKIGDAFMTP LFLKKMTDVT       180
     LNKNYDLDVI LEFYRKVIPR PEELGAEATD YQLSLF                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page