(data stored in ACNUC7421 zone)

EMBL: CP001720.PE121

CP001720.PE121       Location/Qualifiers
FT   CDS             131079..131636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0123"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   noc:Noc_2546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61086"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T0"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ACV61086.1"
FT                   /translation="MGLNVPTVSTGKKYTIEDYLKLDDGQSYELIEGELILVPRPRTKH
FT                   QKIANRFFANLDRFVLMNNLGEVNGDVDVYLEEEVVAPDVFFVAKERLTIVGEMNIQGA
FT                   PDLVVEVLSPSTARYDRKKKSRLYFRNGVKEYWLADPDQQLVEVLVAGEKEWKWIGVFD
FT                   REDILTSNLLPGLEINLGEIFR"
     MGLNVPTVST GKKYTIEDYL KLDDGQSYEL IEGELILVPR PRTKHQKIAN RFFANLDRFV        60
     LMNNLGEVNG DVDVYLEEEV VAPDVFFVAK ERLTIVGEMN IQGAPDLVVE VLSPSTARYD       120
     RKKKSRLYFR NGVKEYWLAD PDQQLVEVLV AGEKEWKWIG VFDREDILTS NLLPGLEINL       180
     GEIFR                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page