(data stored in ACNUC7421 zone)

EMBL: CP001720.PE123

CP001720.PE123       Location/Qualifiers
FT   CDS             complement(132785..133531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0125"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cps:CPS_3640 phosphate ABC transporter, ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61088"
FT                   /db_xref="GOA:C8W2T2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61088.1"
FT                   /translation="MSVHLKNLCVFFNGTPVLKKINLEFKEQVIYAIVGPSGCGKTTLL
FT                   RSINRTAELDRGFSCSGEILLYGKNIYQERDAAEIRRKIGIVFQTPVALPLSIKENVIF
FT                   GIRYLGGANNKQLNYTAEHCLKQAGLWQEVKDKLHKPARELSGGQIQRLSIARTLAVNP
FT                   EVLLLDEPCSNLDPVSAKLIEELLLSLSNRLTVILVTHNLFQARRIAQNTILMSVGCVV
FT                   ESGPTEVMFSTPDRQETKDYFSGLIW"
     MSVHLKNLCV FFNGTPVLKK INLEFKEQVI YAIVGPSGCG KTTLLRSINR TAELDRGFSC        60
     SGEILLYGKN IYQERDAAEI RRKIGIVFQT PVALPLSIKE NVIFGIRYLG GANNKQLNYT       120
     AEHCLKQAGL WQEVKDKLHK PARELSGGQI QRLSIARTLA VNPEVLLLDE PCSNLDPVSA       180
     KLIEELLLSL SNRLTVILVT HNLFQARRIA QNTILMSVGC VVESGPTEVM FSTPDRQETK       240
     DYFSGLIW                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page